Angiotensin IV raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-08-25. Anything still debated is marked as such rather than presented as settled.
Regulatory and commercial contexts differ from clinical medicine. Dihexa is not approved as a drug by major agencies, and no published human trials establish its safety or efficacy. It is often sold as a research chemical labeled for laboratory use only. Suppliers may provide certificates of analysis, but purity and identity depend on the specific batch. Legal status varies by country and may treat such compounds as unapproved substances for human consumption.
Dihexa is a synthetic peptidomimetic derived from angiotensin IV, a naturally occurring peptide fragment. It was created as a research compound to explore central nervous system signaling rather than as an approved therapeutic. Early work described it as a small, orally available molecule in rodent studies. Its structure combines tyrosine, isoleucine, and aminohexanoic acid components with a hexanoic acid cap. The compound is commonly referred to by the research code PNB-0408.
Discussion in the literature often separates direct receptor activation from downstream growth-factor modulation. Dihexa is not simply an angiotensin receptor blocker or a classic nootropic drug. Its proposed action may depend on endogenous HGF levels, which vary by tissue and physiological state. Questions remain about brain penetration, metabolic stability, and active metabolites. Reviews note that mechanistic claims should be treated as hypotheses until supported by independent studies. That distinction is important when interpreting promotional claims or early laboratory findings.
The leading hypothesis for dihexa centers on hepatocyte growth factor (HGF) and its receptor, c-Met. In cell-based assays, dihexa has been reported to potentiate HGF-dependent signaling. That pathway influences cell growth, survival, and motility. Because c-Met signaling is widespread, the proposed mechanism is broad rather than specific to neurons. The exact binding site and stoichiometry remain areas of active investigation, and independent replication is limited. This uncertainty limits firm conclusions about how the compound acts in living organisms.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic angiotensin IV analog | Peptidomimetic |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Soluble in DMSO; limited in water | Typical for small peptides |
| Storage | -20 °C, desiccated | Protect from light and moisture |
| Analytical method | HPLC with UV detection | Purity and identity checks |
The compound has been examined in animal models for effects on learning, memory, and synaptic connectivity. Some reports describe increased dendritic spine density and improved performance on certain behavioral tasks after administration in rodents. These findings are often cited in discussions of nootropic research peptides, but replication across independent laboratories remains limited. The absence of published phase 1 or phase 2 clinical trial data makes it difficult to assess safety, effective routes, or long-term outcomes in humans. Consequently, claims about cognitive benefits in people remain speculative.
Dihexa is not approved as a medicine in major regulatory jurisdictions. It is commonly sold as a research chemical for laboratory use, though such products may not be standardized or independently verified. Scientific literature on dihexa includes in vitro assays, rodent studies, and reviews that discuss its proposed mechanism. The distinction between peer-reviewed findings and commercial promotion is important when evaluating available information. Open questions include its precise binding interactions, pharmacokinetics, and whether animal results translate to human biology.
Dihexa is a synthetic peptide derived from angiotensin IV, a naturally occurring fragment of the renin-angiotensin system. Researchers modified the angiotensin IV structure to improve metabolic stability and central nervous system activity. It is frequently described as a hepatocyte growth factor mimetic because it can activate the c-Met receptor pathway in experimental systems. Its development reflects interest in small peptides that influence synaptic plasticity and cognitive processes. Most information comes from preclinical studies rather than controlled human trials.
Most published work on dihexa consists of preclinical studies using cell cultures or rodents. Reports have described effects on synaptic connectivity and performance on cognitive tasks in some animal models. These findings are generally presented as preliminary and require independent replication. Study designs, doses, and outcome measures vary across experiments, which complicates direct comparison. No large controlled human trials have established efficacy or safety for any medical use. At present, the evidence base is limited.
Regulatory agencies have not approved dihexa as a prescription drug or supplement. In many countries it falls into a gray area when sold for laboratory research. Buyers may encounter products marketed for research use only, which are not intended for human consumption. Purity and identity can vary between suppliers and batches. Certificates of analysis and independent testing are often recommended for research materials. Documentation helps verify what a vial contains.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide whose structure is modeled on angiotensin IV. Its chemical name often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, though vendor and publication naming can differ. The molecule combines a short amino acid sequence with a hexanoic acid group and an amide terminus. It is classed as a small research peptide rather than a conventional drug. Databases may list it under several synonyms, so matching names are important when comparing sources.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
==== Satiety ==== As a peptide hormone, CCK mediates satiety by acting on the CCK receptors distributed widely throughout the central nervous system. The mechanism for hunger suppression is thought to be a decrease in the rate of gastric emptying. CCK also has stimulatory effects on the vagus nerve, effects that can be inhibited by capsaicin. The stimulatory effects of CCK oppose those of ghrelin, which has been shown to inhibit the vagus nerve. The effects of CCK vary between individuals. For example, in rats, CCK administration significantly reduces hunger in adult males, but is slightly less effective in younger subjects, and even slightly less effective in females. The hunger-suppressive effects of CCK also are reduced in obese rats.
== External links == Investigational New Drug (IND) Application Process Center for Drug Evaluation and Research, Food and Drug Administration. ICH Guidance for Industry, E6 Good Clinical Practice: Consolidated Guidance. BROKEN LINK Troetel, W.M.: Achieving a Successful US IND Filing (1) The Regulatory Affairs Journal. 6: 22–28, January 1995. Troetel, W.M.: Achieving a Successful US IND Filing (2) The Regulatory Affairs Journal. 6: 104–108, February 1995. Henninger, Daniel (2002). "Drug Lag". In David R. Henderson (ed.). Concise Encyclopedia of Economics (1st ed.). Library of Economics and Liberty. Archived from the original on 2020-12-04. Retrieved 2013-08-31. OCLC 317650570, 50016270, 163149563 IND Forms and Instructions from the US Food and Drug Administration
=== General characteristics of the active substance === Salmon calcitonin is rapidly absorbed and eliminated. Peak plasma concentrations are attained within the first hour of administration. Animal studies have shown that calcitonin is primarily metabolised via proteolysis in the kidney following parenteral administration. The metabolites lack the specific biological activity of calcitonin. Bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively). Calcitonin has short absorption and elimination half-lives of 10–15 minutes and 50–80 minutes, respectively. Salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. Therefore, the metabolic clearance is much lower in patients with end-stage kidney failure than in healthy subjects. However, the clinical relevance of this finding is not known. Plasma protein binding is 30% to 40%.
== Side effects and risks == Risks of an improperly performed dermal filler procedure commonly include bruising, redness, pain, or itching. Less commonly, there may be infections or allergic reactions, which may cause scarring and lumps that may require surgical correction. In 2024, a cluster of HIV infections was described amongst clients receiving microneedling facials at a spa. More rarely, serious adverse effects such as blindness due to retrograde (opposite the direction of normal blood flow) embolization into the ophthalmic and retinal arteries can occur. Delayed skin necrosis can also occur as a complication of embolization. Embolic complications are more frequently seen when autologous fat is used as a filler, followed by hyaluronic acid. Though rare, when vision loss does occur, it is usually permanent.
Puillandre, N.; Meyer, C.P.; Bouchet, P.; Olivera, B.M. (2011). "Genetic divergence and geographical variation in the deep-water Conus orbignyi complex (Mollusca: Conoidea)". Zoologica Scripta. 40 (4): 350–363. doi:10.1111/j.1463-6409.2011.00478.x. PMC 3123138. PMID 21712968. Puillandre, N.; Duda, T.F.; Meyer, C.; Olivera, B.M.; Bouchet, P. (2015). "One, four or 100 genera? A new classification of the cone snails". Journal of Molluscan Studies. 81 (1): 1–23. doi:10.1093/mollus/eyu055. PMC 4541476. PMID 26300576. Puillandre, N.; et al. (2014). "Molecular phylogeny and evolution of the cone snails (Gastropoda, Conoidea)". Mol. Phylogenet. Evol. 78: 290–303. Bibcode:2014MolPE..78..290P. doi:10.1016/j.ympev.2014.05.023. PMC 5556946. PMID 24878223. Reeve L (1844). "Conchologia Iconica". Monograph of the genus Conus. Vol. 1. pp. 40–47. Sowerby, G. B., II. 1833. Conus. Conchological Illustrations pls. 36–37 Taylor, J. D.; Kantor, Yu. I.; Sysoev, A. V. (1993). "Foregut anatomy, feeding mechanisms, relationships and classification of Conoidea (Toxoglossa) (Gastropoda)". Bull. Nat. Hist. Mus. 59: 125–169. Tenorio MJ, Tucker JK, Chaney HW (2012). "The Families Conilithidae and Conidae. The Cones of the Eastern Pacific". In Poppe GT, Groh K (eds.). A Conchological Iconography. Hackenheim: ConchBooks. p. 112. Tucker J.K. & Tenorio M.J. (2009), Systematic Classification of Recent and Fossil Conoidean Gastropods, ConchBooks, Hankenheim, Germany, 295 pp. Van Mol JJ, Tursch B, Kempf M (1967). "Mollusques prosobranches: Les Conidae du Brésil.
Sources: en.wikipedia.org
On 29 March, Trump stated that he would prefer to "take the oil in Iran". He proposed taking Iran's oil export center, Kharg Island, claiming that the United States could capture the territory "very easily", and implying that the US could occupy it for some time. On 30 March, Trump said that if a deal were not reached soon and the Strait of Hormuz reopened, the US would strike all of Iran's power plants, oil wells, Kharg Island, and possibly all its desalinization plants, although the feasibility and strategic value of some of Trump's threats were contested. On the same day Turkey and NATO intercepted the fourth missile directed towards Turkish territory. Iran denied firing a missile at Turkey, claiming that it was a false flag attack. The US began flying B-52 bombers over Iranian territory for the first time, indicating its confidence of air supremacy over Iran. The US used bombers to target an ammunition depot and air base in Isfahan, causing large explosions. U.S-allied Gulf states such as Saudi Arabia, the UAE, Kuwait, and Bahrain reportedly pushed Trump to continue the war until there are significant changes in Iran's leadership. American journalist Shelly Kittleson was kidnapped in Baghdad by Kata'ib Hezbollah—the strongest faction within the PMF—who demanded that the Iraqi government release several detained members of the group. On 1 April, Mehr News Agency, a semi-official Iranian government news outlet, reported that policy expert and former foreign minister Kamal Kharazi was seriously injured and his wife was killed in an airstrike which hit his home.
Tanning is especially polluting in countries where environmental regulations are lax, such as in India, the world's third-largest producer and exporter of leather. To give an example of an efficient pollution prevention system, chromium loads per produced tonne are generally abated from 8 kg to 1.5 kg. VOC emissions are typically reduced from 30 kg/t to 2 kg/t in a properly managed facility. A review of the total pollution load decrease achievable according to the United Nations Industrial Development Organization posts precise data on the abatement achievable through industrially proven low-waste advanced methods, while noting, "even though the chrome pollution load can be decreased by 94% on introducing advanced technologies, the minimum residual load 0.15 kg/t raw hide can still cause difficulties when using landfills and composting sludge from wastewater treatment on account of the regulations currently in force in some countries." In Kanpur, the self-proclaimed "Leather City of World"—with 10,000 tanneries as of 2011 and a city of three million on the banks of the Ganges—pollution levels were so high, that despite an industry crisis, the pollution control board decided to shut down 49 high-polluting tanneries out of 404 in July 2009. In 2003 for instance, the main tanneries' effluent disposal unit was dumping 22 tonnes of chromium-laden solid waste per day in the open. In the Hazaribagh neighborhood of Dhaka in Bangladesh, chemicals from tanneries end up in Dhaka's main river.
Plants rely on micronutrients to build many essential proteins. In fact, every process that supports the growth of a plant is mediated by some protein which contains one of the many micronutrients. For example, Mn is an essential micronutrient for many plants because it builds the structure of photosystem II which splits water molecules to harness energy from electrons. Inadequate micronutrient uptake can result in deficiencies and even mortality in extreme cases. Alternatively, elevated concentrations of micronutrients in soils can result in toxicity.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
Dihexa is a synthetic peptidomimetic related to angiotensin IV. It is studied in preclinical research for effects on synaptic signaling and cognition. It is not an approved medication.
No major drug regulatory agency has approved dihexa for human use. Published human clinical trials are absent, so its safety and efficacy are not established. It is commonly sold for laboratory research only.
It was developed from research on angiotensin IV analogs and peptide stability. The goal was to find compounds with better brain penetration and metabolic resistance. Early studies used rodent models rather than human participants.
It is thought to enhance hepatocyte growth factor signaling through the c-Met receptor. This pathway is involved in cell growth and repair. The precise molecular details are not fully established.